}, { "action" : "rerender" } "context" : "lia-deleted-state", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "unapproveMessage", "componentId" : "kudos.widget.button", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", } // We're good so far. { "disableLinks" : "false", } "action" : "rerender" "event" : "ProductMessageEdit", { { { { ] "context" : "envParam:selectedMessage", "actions" : [ function processPageInputBlur(pagerId, val) "actions" : [ }); "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); }, }); } Bist du sicher, dass du fortfahren möchtest? ', 'ajax'); "actions" : [ "disableLinks" : "false", "showCountOnly" : "false", "showCountOnly" : "false", { $(document).ready(function(){ "eventActions" : [ { { "event" : "RevokeSolutionAction", "actions" : [ "action" : "rerender" { "closeEvent" : "LITHIUM:lightboxCloseEvent", } { "event" : "deleteMessage", { "context" : "", "context" : "", "}); "context" : "", { "actions" : [ }, { "context" : "envParam:quiltName", "actions" : [ "action" : "pulsate" "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName,message", }, "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", }); ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] }, ] { "actions" : [ { { "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); Bist du sicher, dass du fortfahren möchtest? "useTruncatedSubject" : "true", { "selector" : "#messageview_8", "disableLabelLinks" : "false", { { "context" : "", "action" : "rerender" "context" : "envParam:selectedMessage", "actions" : [ "event" : "RevokeSolutionAction", "context" : "", "eventActions" : [ "eventActions" : [ // We made it! ... Bei einem Vodafone-Modem müssen Sie sich dazu im ... Ist die Fritzbox hinter … }, ] })(LITHIUM.jQuery); "actions" : [ "context" : "envParam:feedbackData", }, { { "actions" : [ "displaySubject" : "true", "useSubjectIcons" : "true", "actions" : [ LITHIUM.AjaxSupport.useTickets = false; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'seteh4vhH6P10ZA-fXuog9Y_3V1sBdSmTVLKGeonY8o. "parameters" : { { o.innerHTML = "Page number must be 1 or greater. ] ] { { { } count = 0; "initiatorBinding" : true, "action" : "rerender" } "showCountOnly" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", }, LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); ] "displaySubject" : "true", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "componentId" : "kudos.widget.button", "actions" : [ { ;(function($) { { "context" : "", "context" : "envParam:quiltName,expandedQuiltName", ] "action" : "rerender" "useTruncatedSubject" : "true", "action" : "rerender" { ] } ] } "event" : "MessagesWidgetMessageEdit", "context" : "envParam:selectedMessage", "actions" : [ { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); ] LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "expandMessage", "action" : "rerender" { "disableKudosForAnonUser" : "false", "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045314 .lia-rating-control-passive', '#form_9'); "context" : "", "actions" : [ } } }, } "truncateBody" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName,message", "action" : "pulsate" "revokeMode" : "true", "context" : "envParam:selectedMessage", ] "context" : "", "actions" : [ "disableKudosForAnonUser" : "false", "event" : "addMessageUserEmailSubscription", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045173 .lia-rating-control-passive', '#form_4'); "action" : "rerender" }, { ] { "context" : "envParam:quiltName", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045040,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] } } } }, { } { "actions" : [ "actions" : [ { "action" : "rerender" }, "}); ] "context" : "envParam:quiltName", "initiatorBinding" : true, "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "event" : "MessagesWidgetEditAction", "actions" : [ "context" : "envParam:feedbackData", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045234 .lia-rating-control-passive', '#form_6'); "actions" : [ ] "action" : "addClassName" "action" : "addClassName" } "actions" : [ ], "action" : "rerender" { "event" : "addThreadUserEmailSubscription", "displaySubject" : "true", "event" : "addThreadUserEmailSubscription", if (isNaN(val) ) "action" : "pulsate" "event" : "editProductMessage", "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Bist du sicher, dass du fortfahren möchtest? { ', 'ajax'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetEditCommentForm", }, { { })(LITHIUM.jQuery); { { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "useSubjectIcons" : "true", ] { } "actions" : [ "disableLinks" : "false", "context" : "", "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ "context" : "lia-deleted-state", "useCountToKudo" : "false", "context" : "", { "actions" : [ }); LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ ] ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] }, ;(function($) { } }, "actions" : [ ] { "context" : "envParam:quiltName", "context" : "envParam:entity", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1064,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk1+CkFWRlwAQkt+VxBHdFcQcgBGAGpJf0ALFk0GWksZBVAPVhRfCxYaL1RRUV4EWBVaWg4XRBcYVl1cF18FUUYHDGtLQVcZQjkZVAkGVlUFVhcfFlQXVwtcewZADVUHBQACVw5VDAZbVRtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsKVFFVBlNQVR9UUlQKH1ZWUwAYUlFWVhsFAAtaWlUBDQVRVAEUShtZASxYAFB6UBBfFC9XRgcQWQFBHnFcAVEDS1MHFlJGGRFfUTdTFU1kUDNCAUdKFghHZSN1dyE2Fw1RE3JgKntGVFcREVYDUEAUZS1zNHwSFg1HDVYdXVZYCUZ1ey8rY0QKEUlP"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "actions" : [ var key = e.keyCode; { } ] "initiatorDataMatcher" : "data-lia-message-uid" } { "actions" : [ } "action" : "rerender" { }, "disallowZeroCount" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045241,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:entity", "displayStyle" : "horizontal", { "context" : "", { ', 'ajax'); setWarning(pagerId); { ] "useSimpleView" : "false", "action" : "rerender" }, ] "event" : "MessagesWidgetAnswerForm", "actions" : [ "quiltName" : "ForumMessage", "event" : "deleteMessage", }, { { ] "context" : "", }, "parameters" : { "event" : "addThreadUserEmailSubscription", \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; "action" : "pulsate" ;(function($) { ] "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditAnswerForm", "componentId" : "forums.widget.message-view", "event" : "removeThreadUserEmailSubscription", "actions" : [ ] ] "actions" : [ { ] }, ] "context" : "", { "dialogKey" : "dialogKey" "action" : "rerender" "displaySubject" : "true", } { "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "context" : "envParam:feedbackData", } LITHIUM.AjaxSupport.ComponentEvents.set({ "entity" : "2045179", ] "actions" : [ } "context" : "envParam:quiltName,expandedQuiltName", "disableKudosForAnonUser" : "false", "event" : "markAsSpamWithoutRedirect", CookieManager = { "action" : "pulsate" "event" : "deleteMessage", } document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); $(document).ready(function(){ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); { $(document).ready(function(){ // Oops, not the right sequence, lets restart from the top. $(document).ready(function(){ "action" : "pulsate" "useSubjectIcons" : "true", "event" : "MessagesWidgetMessageEdit", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "removeMessageUserEmailSubscription", "dialogKey" : "dialogKey" } { "actions" : [ "context" : "", "actions" : [ ;(function($) { "initiatorBinding" : true, "event" : "MessagesWidgetCommentForm", "action" : "rerender" "context" : "", "event" : "AcceptSolutionAction", "action" : "rerender" "action" : "rerender" return false; "actions" : [ } "truncateBodyRetainsHtml" : "false", "action" : "pulsate" "actions" : [ } { } }, "actions" : [ } { ', 'ajax'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); "entity" : "2045040", } } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045241,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, ] })(LITHIUM.jQuery); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", ] }, }, "initiatorBinding" : true, { }, ] "actions" : [ "disallowZeroCount" : "false", "action" : "rerender" { }, "context" : "", "event" : "addMessageUserEmailSubscription", "action" : "pulsate" } { "action" : "rerender" "actions" : [ { "actions" : [ ] "actions" : [ { "action" : "rerender" Hier ist alles genau erklärt, wie es angeschlossen werden muss: https://avm.de/service/fritzbox/fritzbox-7590/wissensdatenbank/publication/show/16_FRITZ-Box-fur-Bet... WLAN geht dann über die 7590! ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045173,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/105641","ajaxErrorEventName":"LITHIUM:ajaxError","token":"e3MDS0BtRCvlBlwc-vek8xiOfBMa9fhORwi0_uKpe0A. "selector" : "#kudosButtonV2_7", "componentId" : "forums.widget.message-view", function disableInput(pagerId) { "context" : "", { "dialogContentCssClass" : "lia-panel-dialog-content", Bist du sicher, dass du fortfahren möchtest? "context" : "lia-deleted-state", "event" : "editProductMessage", "initiatorDataMatcher" : "data-lia-kudos-id" { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/105641","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eRSE9RhNkkoY6urUg9F-ZrJgWbz5ANKFWO_6LOxDUSw. } { "context" : "envParam:quiltName,product,contextId,contextUrl", "showCountOnly" : "false", resetMenu(); "}); } "event" : "markAsSpamWithoutRedirect", LITHIUM.AjaxSupport.useTickets = false; }, "event" : "approveMessage", "event" : "addThreadUserEmailSubscription", "initiatorBinding" : true, { "action" : "rerender" }, }, "eventActions" : [ "displaySubject" : "true", "quiltName" : "ForumMessage", }, LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "action" : "rerender" { { ] LITHIUM.Dialog.options['233560562'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useCountToKudo" : "false", "context" : "", "event" : "ProductAnswerComment", "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" { ;(function($) { "event" : "RevokeSolutionAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); ] } { { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'zwP8kgrIy3uz409fekiiCALulBtAbNMOniYirR0motg. "useSimpleView" : "false", ] "action" : "rerender" "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/123456/thread-id/60719","ajaxErrorEventName":"LITHIUM:ajaxError","token":"VLCq5QO10ev8EKaGhRp5VFOvlFKTcubIzunYu7iTKuM. { "action" : "rerender" } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "rerender" } "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); { ] "event" : "addMessageUserEmailSubscription", "action" : "rerender" } "action" : "rerender" "event" : "expandMessage", { "context" : "", } { } "context" : "", ] }, { ] }, "actions" : [ "componentId" : "forums.widget.message-view", "actions" : [ $(document).ready(function(){ "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "showCountOnly" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "actions" : [ "initiatorBinding" : true, ] "event" : "editProductMessage", { "action" : "rerender" "showCountOnly" : "false", // If watching, pay attention to key presses, looking for right sequence. "forceSearchRequestParameterForBlurbBuilder" : "false", watching = false; { "componentId" : "kudos.widget.button", "action" : "pulsate" ;(function($) { }); ] "message" : "2045234", "componentId" : "forums.widget.message-view", "event" : "markAsSpamWithoutRedirect", "action" : "rerender" "action" : "rerender" }); "event" : "kudoEntity", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", "actions" : [ "selector" : "#messageview_9", }); ] "event" : "AcceptSolutionAction", } "parameters" : { "actions" : [ "parameters" : { "quiltName" : "ForumMessage", "action" : "pulsate" { "event" : "MessagesWidgetAnswerForm", "disableLinks" : "false", } "revokeMode" : "true", "event" : "ProductMessageEdit", "actions" : [ }, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ } }, { } }, setWarning(pagerId); "event" : "MessagesWidgetEditCommentForm", ] "context" : "envParam:quiltName,expandedQuiltName", "disableKudosForAnonUser" : "false", "revokeMode" : "true", ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",